PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G085200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 367aa    MW: 39824.6 Da    PI: 6.3541
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G085200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88e-1659106148
                         TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+W++eEde l +    +Gg+  W++Ia +++ gR +kqc++rw ++l
  Brast01G085200.1.p  59 KGAWSQEEDEVLRKMMDTYGGEpKWALIATHLP-GRIGKQCRERWMNHL 106
                         79*******************9***********.*************97 PP

2Myb_DNA-binding46.48.9e-15116156446
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         W   +d+ l++++ ++G++ W+ Iar+++ gR+++++k++w+ 
  Brast01G085200.1.p 116 WFDADDKALIRGHMRHGNR-WSEIARHLP-GRSENDVKNHWNA 156
                         77789**************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.6554110IPR017930Myb domain
SuperFamilySSF466895.19E-2757154IPR009057Homeodomain-like
SMARTSM007172.0E-1358108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2060113IPR009057Homeodomain-like
CDDcd001677.78E-1361106No hitNo description
PfamPF139211.3E-1462122No hitNo description
PROSITE profilePS5129414.538112162IPR017930Myb domain
SMARTSM007171.1E-12112160IPR001005SANT/Myb domain
CDDcd001675.94E-12115155No hitNo description
Gene3DG3DSA:1.10.10.603.8E-15115156IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MPVVAGNGMA PGNFAMPEGS LAATGGAVVP VEATAAPSRR PRAARNNRDR HGNQAPVLKG  60
AWSQEEDEVL RKMMDTYGGE PKWALIATHL PGRIGKQCRE RWMNHLRPEL MKDAPWFDAD  120
DKALIRGHMR HGNRWSEIAR HLPGRSENDV KNHWNAVRRS LGSKRQFKKK KSEQAPPGQF  180
TALEQYIRSK YPPDTEPTSP PPSAPASASS SGPDGPNAAA TLALAGSSQT GMDMYLGYPA  240
GSSNGGTSNL NAHLLPPELN DYSSFPYVPS MPYEMQVPAL PPMMAGADQE HLQAAEYVNH  300
LNVLPVGCAD QENVENIVKF EGQASYYSEA SMGPSCTGEL DDVVQMASRQ FMTPSEDEVT  360
LDLSKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-34571592102C-Myb DNA-Binding Domain
1msf_C4e-34571592102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3GHR81e-156A0A0Q3GHR8_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.16e-39myb domain protein 118